Protein Info for HSERO_RS08740 in Herbaspirillum seropedicae SmR1

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 361 to 361 (1 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details PF02447: GntP_permease" amino acids 9 to 447 (439 residues), 542.6 bits, see alignment E=7e-167 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 10 to 450 (441 residues), 501.5 bits, see alignment E=1.2e-154 PF03600: CitMHS" amino acids 24 to 396 (373 residues), 44.1 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 54% identical to GNUT_PSEAE: Gluconate permease (gnuT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to hse:Hsero_1752)

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IR04 at UniProt or InterPro

Protein Sequence (450 amino acids)

>HSERO_RS08740 permease (Herbaspirillum seropedicae SmR1)
MEAVQGSALLVYALVAVIALIVLIAKFKMNPFIVLIVVSLVLGLAVGMPMGNIVKAFETG
VGNALGHIALVVGLGTMLGKMMAESGGAERIANTMIKAFGEKNVHWAMMTVAFIVGLPVF
FEVGFVLLVPIAFNVAKRTGTNMVLVGIPMVAGLSVVHGLIPPHPAALLAVTAYSADIGR
TILYALIVGIPTAIIAGPIFGKLISKVVIPNPDNPLISQFVDEGKKDRELPGFGITLFTI
LLPVALMLIGSWADLFFAPKTFANDFLRLIGNSVIALLIATLVSFWTFGRARGFGADQIL
KFTNECLAPIASITLVVGAGAGFGRILMDGGVSKAIVGIATDAHLSPLILGWFVAALIRV
ATGSATVAMTTACGIVAPIVSTVGGVRPELMVLATGAGSLILSHVNDGGFWLVKEYFNMT
VPQTFKTWTVMETLVSVLALLFTLALATVV