Protein Info for HSERO_RS08280 in Herbaspirillum seropedicae SmR1

Annotation: leucine/isoleucine/valine transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 184 to 200 (17 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 339 to 366 (28 residues), see Phobius details amino acids 375 to 392 (18 residues), see Phobius details PF11862: DUF3382" amino acids 4 to 94 (91 residues), 77.9 bits, see alignment E=5.8e-26 PF02653: BPD_transp_2" amino acids 103 to 389 (287 residues), 186.6 bits, see alignment E=5.3e-59

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_1664)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQR6 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HSERO_RS08280 leucine/isoleucine/valine transporter permease subunit (Herbaspirillum seropedicae SmR1)
MPETFKNAVTAALVTAVLTIPLLGMQLQLEGYRVVLNTHWTPVLVAVLAVFLFQLAKPVL
SRSSAGIKLPALPRMQPRQQRAAVMILLMAALVWPFFGSRGYVDVMTLALIYVVLGLGLN
IVVGFAGLLDLGYVGFYAVGAYTYALCNQYFGLTFWECVPLAAAASALFGFLLGFPVLRL
RGDYLAIVTLGFGEIIRLLLNNMTSITGGPDGVSGIPKPTVFGLVMARNPVTEGGTTFHQ
LFGLSYQGGHMVIFLYFLALLMVLFTYFVTSRLLRMPMGRAWEALREDEIACRSLGINPT
KVKLSAFTLGAAFAGLAGSFFAARQGLVTPESFTFIESALILAIVVLGGMGSQLGVILAA
ILLTVLPELARSFAEYRMLIFGLVMVLMMMWRPQGLLPATRPHVELPQ