Protein Info for HSERO_RS08235 in Herbaspirillum seropedicae SmR1

Annotation: sulfate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 31 to 290 (260 residues), 418.1 bits, see alignment E=1.4e-129 TIGR00969: sulfate ABC transporter, permease protein" amino acids 33 to 288 (256 residues), 328.3 bits, see alignment E=4e-102 PF00528: BPD_transp_1" amino acids 95 to 288 (194 residues), 55 bits, see alignment E=4.5e-19

Best Hits

Swiss-Prot: 54% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to hse:Hsero_1656)

MetaCyc: 54% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQQ8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>HSERO_RS08235 sulfate ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSAAPISAAHQAIARGEPPLTPAATAEPFWVRALLIGIALAFLTLFLFVPLVAVFYEALR
KGWDVYVASITEADAWSAIKLTLITAAIAVPLNLVFGVAAAWAIAKFEFRGKNLLLTLID
LPFSVSPVISGLIYVLLFGLQGYLGPWLREHDIKILFAVPGIVLATIFVTFPFVARELIP
LMQSQGSEEEEAALVLGASGWRTFWHVTLPNIKWGLLYGVILCNARAMGEFGAVSVVSGH
IRGETNTIPLQVEILYNEFNITGAFAVASLLAFLALVTLAIKSVIEWRLHQQHSASEQV