Protein Info for HSERO_RS08230 in Herbaspirillum seropedicae SmR1

Annotation: sulfate/thiosulfate transporter subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 26 to 289 (264 residues), 428.8 bits, see alignment E=8.9e-133 TIGR00969: sulfate ABC transporter, permease protein" amino acids 26 to 285 (260 residues), 336.1 bits, see alignment E=1.7e-104 PF00528: BPD_transp_1" amino acids 92 to 288 (197 residues), 78.1 bits, see alignment E=3.7e-26

Best Hits

Swiss-Prot: 56% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to hse:Hsero_1655)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQQ7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HSERO_RS08230 sulfate/thiosulfate transporter subunit (Herbaspirillum seropedicae SmR1)
MSASPVSLAAPRAAPAAASGGSGRRVLPGFRLSLGFTLFYLALIVLIPLSALFLKTFTLT
WEGFIEAVTSPRVMASYRLSFGASLIGAFLNVIFGGIVAWVLVRYRFPGKRIIDALVDLP
FALPTAVAGIALTTLYSQNGWLGKLLAPLGIKVAFTPLGVLVALTFIGLPFVVRTVQPVL
EEAERELEEAAASLGASRWQTFTRVIFPTVLPALLTGFALAFARASGEYGSVVFIAGNMP
MVSEITPLFIVTKLEQYDYAGATAIAMVMLLVSFVLLLTINLLQAWTRKRGQSERI