Protein Info for HSERO_RS08205 in Herbaspirillum seropedicae SmR1

Annotation: sulfonate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 190 to 224 (35 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 269 (168 residues), 105.7 bits, see alignment E=1.2e-34

Best Hits

Swiss-Prot: 68% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_1650)

MetaCyc: 68% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQQ2 at UniProt or InterPro

Protein Sequence (279 amino acids)

>HSERO_RS08205 sulfonate ABC transporter (Herbaspirillum seropedicae SmR1)
MTSASNPVAGRVAGPQEQAKPKAARKSFQPSHAWIGWLLPLLLLVWWEVAAQAGWLSSRI
LPEPLAVLKAAWELSASGELWRHLAVSSGRAASGFAVGAGLGLILGLLSGSLRSAELLLD
TTLQMVRNIPALALIPLVILWFGIDETAKLFLVSVGVFFPVYLNTFHGIRSVDQGLIEMA
KSYGLSGWPLYRDVILPGALPAILVGLRFALGLVWVLLIVAETISAQAGIGYMTMNAREF
LQTDVVLVGILLYALLGKLADTAARWLERFWLRWHPGYQ