Protein Info for HSERO_RS08085 in Herbaspirillum seropedicae SmR1

Annotation: ferredoxin--NADP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 311 to 328 (18 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 17 to 301 (285 residues), 89.2 bits, see alignment E=4.9e-29 PF13738: Pyr_redox_3" amino acids 71 to 298 (228 residues), 87.5 bits, see alignment E=1.5e-28 PF00070: Pyr_redox" amino acids 165 to 225 (61 residues), 23.6 bits, see alignment E=9.5e-09

Best Hits

Swiss-Prot: 85% identical to FENR2_CUPNH: Ferredoxin--NADP reductase 2 (H16_A2592) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to hse:Hsero_1624)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQM6 at UniProt or InterPro

Protein Sequence (357 amino acids)

>HSERO_RS08085 ferredoxin--NADP reductase (Herbaspirillum seropedicae SmR1)
MENNVQTAAANGVIDADAVIIGAGPVGLFQVFELGLLEIKAHVIDSLPVVGGQCVELYPD
KPIYDIPAVPVCTGQELTDNLLKQIEPFSPTFHLGQEVTLVNKREDGRFDVETSTGTKFI
TKTIFIAAGVGSFQPRTLKVEGIEQFEGSQVFYRVKDPALFEGKNIVICGGGDSALDWAL
NFVGKAESVILLHRREEFRAAPASVAKMKELCEQYEMQLLIGQVTGTEIKDGKLAEVKVT
GADGVTRRLPLDMLLVFFGLSPKLGPIAEWGLEIERKQLKVMDTEKFETNVPGIFAVGDI
NTYPGKKKLILSGFHEAALAAFGAAPYIFPEKKIHMQYTTTSPKLHKILGVESPVFD