Protein Info for HSERO_RS07760 in Herbaspirillum seropedicae SmR1

Annotation: fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00722: hydrolyase, tartrate alpha subunit/fumarate domain protein, Fe-S type
  • amino acids 11 to 286 (276 residues), 215 bits, E=1.1e-67
• PF05681: Fumerase
  • amino acids 11 to 285 (275 residues), 327.4 bits, E=7e-102
• PF05683: Fumerase_C
  • amino acids 289 to 490 (202 residues), 289 bits, E=1.6e-90
• TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type
  • amino acids 327 to 488 (162 residues), 159.4 bits, E=7.9e-51

Best Hits

KEGG orthology group: K01676, fumarate hydratase, class I [EC: 4.2.1.2] (inferred from 100% identity to hse:Hsero_1543)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• TCA cycle III (animals) (7/10 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• reductive TCA cycle II (6/12 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• methylaspartate cycle (9/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

See D8IQ11 at UniProt or InterPro

Protein Sequence (513 amino acids)

>HSERO_RS07760 fumarate hydratase (Herbaspirillum seropedicae SmR1)
MTIIKQDDLIESVAAALQYISYYHPADYIQHLARAYETEQSPAAKDAIAQILTNSRMCAE
GKRPICQDTGIVNVFLKIGMGVRFEGFSGSIADAVNEGVRRGYSHPDNVLRASIVADPQF
ERKNTKDNTPAVIHMELVPGNTVDVQIAAKGGGSENKTKFVMLNPSDNLVDWVLKTVPTM
GAGWCPPGMLGIGIGGTAEKAMLMAKEVLMEDIDMYELLKRGPQNKTEELRIELYEKVNA
LGIGAQGLGGLTTVLDVKIMMHPTHAASKPVAMIPNCAATRHGHFVLDGSGPAYMEPPSL
SDWPEVHWVADTEKSKRVNLDTLTKEEVASWKPGQTLLLNGKMLTGRDAAHKRIQDMLAK
GEKLPVDFTNRVIYYVGPVDPVRDEVVGPAGPTTATRMDKFTDMMLEQTGLISMIGKSER
GPAAIEAIKKHKSAYLMAVGGSAYLVSKAIKSAKVLGFADLGMEAIYEFDVKDMPVTVAV
DANGVSVHNTGPAEWKEKIAQSVSLSKIPVTTA