Protein Info for HSERO_RS07675 in Herbaspirillum seropedicae SmR1

Annotation: multidrug DMT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details PF00892: EamA" amino acids 13 to 142 (130 residues), 73.6 bits, see alignment E=9.4e-25 amino acids 157 to 287 (131 residues), 73.4 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1526)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPZ5 at UniProt or InterPro

Protein Sequence (302 amino acids)

>HSERO_RS07675 multidrug DMT transporter (Herbaspirillum seropedicae SmR1)
LRIAMHYKHLWFPLGAVLIWAGNTVISKMSASVIAPEDISFYRWVLAALLMSPFLARQTW
AARAQIRPHLGKIVVLALLGMVLFQSLAYFAAATASATSMGIIASLMPLLTLVLSIKLLS
EPPTVGTLGGGILSLLGLAVLIGRGHPLALFEQGVVTGDLLMLLATIAYGLYGVMLRRWA
LPLRTWQLLYMQVLMAVVLLFPGFVLGHHSPVTRENLPILLYAGIAASIISQFLWMRGVA
YLGASRCAIFVNLMPVFTVIIAVLALGEQLHGYHAVGGVITLGGVIMAQVFRQRLRWRRL
PG