Protein Info for HSERO_RS07425 in Herbaspirillum seropedicae SmR1

Annotation: formate dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF01512: Complex1_51K" amino acids 151 to 320 (170 residues), 153.1 bits, see alignment E=5.8e-49 PF10589: NADH_4Fe-4S" amino acids 432 to 513 (82 residues), 94.6 bits, see alignment E=2.7e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1476)

Predicted SEED Role

"NAD-dependent formate dehydrogenase beta subunit" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPH1 at UniProt or InterPro

Protein Sequence (520 amino acids)

>HSERO_RS07425 formate dehydrogenase subunit beta (Herbaspirillum seropedicae SmR1)
MSANDTVTVYVPRDSTALALGANEVAAAITAEAHKRGQSIKLVRNGSRGMFWLEPLVEVA
TAAGRVAYGPVAPEDVAGLFDAGLLQGGQHALHLGLTEEIAFLKNQERLTFARVGIIDPL
SLEDYLAHEGYVGLKNALAKTPEAIVQEMIASGLRGRGGAAFPTGIKWQTVLRAQSAQKY
VVCNADEGDSGTFSDRMIMEDDPFTLIEGMTIAGVAVGATEGYIYVRSEYPHSIATLEQA
IAIAHAQGYLGDDILGSGKSFRLEVRKGAGAYICGEETAMLESLEGKRGVVRAKPPLPAI
EGLFGKPTVINNLISLASVPVILARGADFYKNFGVGRSHGTLPFQLAGNIRQGGLVEKAF
GLTLRQLLEDFGGGSASGRPIRAVQMGGPLGAYLPQSQFDTPLDYEAFAAIGAMIGHGGL
VAFDDSVDMARQARYAMQFCAVESCGKCTPCRIGSTRGVEVIDKIIANDDRAQQIHLLKS
LCDTMVNGSLCAMGGMTPFPVLSALNHFPEDFGAPSEQAA