Protein Info for HSERO_RS07285 in Herbaspirillum seropedicae SmR1

Annotation: DNA polymerase III subunit chi

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF04364: DNA_pol3_chi" amino acids 1 to 133 (133 residues), 136.4 bits, see alignment E=3.9e-44

Best Hits

KEGG orthology group: K02339, DNA polymerase III subunit chi [EC: 2.7.7.7] (inferred from 100% identity to hse:Hsero_1449)

Predicted SEED Role

"DNA polymerase III chi subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPE5 at UniProt or InterPro

Protein Sequence (139 amino acids)

>HSERO_RS07285 DNA polymerase III subunit chi (Herbaspirillum seropedicae SmR1)
MTRIDFHSNVPQKITYVCRLVRKARATGVNIVVRSPDAAQLQQLDQALWSFSEQDFLPHV
MAKDPLAAQTAIILTSDDAAELPHHQLLINLGADTPAHFARFERLLEIISADDADKAAGR
DRYRFYKERGYPLTHHVAA