Protein Info for HSERO_RS07200 in Herbaspirillum seropedicae SmR1

Annotation: pterin-4-alpha-carbinolamine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to PHS_BDEBA: Putative pterin-4-alpha-carbinolamine dehydratase (Bd0889) from Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 100% identity to hse:Hsero_1432)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

L-phenylalanine degradation V (3/3 steps found)
tetrahydropteridine recycling (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPC8 at UniProt or InterPro

Protein Sequence (118 amino acids)

>HSERO_RS07200 pterin-4-alpha-carbinolamine dehydratase (Herbaspirillum seropedicae SmR1)
MSITASTLAAAHCIQPVDALDDSAITAHLAVLPDWQIEAGKLVRSFAFNNYYETLAFVNA
IAWMIHAEDHHPELIVSYNRCTVKFDTHSVNAGRGGLSANDFVCAAKVDALFAQRAHA