Protein Info for HSERO_RS07050 in Herbaspirillum seropedicae SmR1

Annotation: peptidase A8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 21 to 168 (148 residues), 140.6 bits, see alignment E=2.2e-45 PF01252: Peptidase_A8" amino acids 25 to 165 (141 residues), 149.6 bits, see alignment E=3.6e-48

Best Hits

Swiss-Prot: 74% identical to LSPA_JANMA: Lipoprotein signal peptidase (lspA) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to hse:Hsero_1403)

MetaCyc: 48% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IP99 at UniProt or InterPro

Protein Sequence (171 amino acids)

>HSERO_RS07050 peptidase A8 (Herbaspirillum seropedicae SmR1)
MATKKRSSSSSASSSTQGLLPWLGIATIVLLLDQLSKITILKLFHYGESLPVTGFFNLVL
VYNKGAAFSFLAASGGWQRYLFTAIGIGAAVFIIHLLRKHPGQRMFCWALALILGGAIGN
VIDRVVYGHVIDFLDVYVGNWHWPAFNIADSAICVGAVLFVVDELRRVSRK