Protein Info for HSERO_RS07015 in Herbaspirillum seropedicae SmR1

Annotation: isocitrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR00183: isocitrate dehydrogenase, NADP-dependent" amino acids 3 to 418 (416 residues), 713.2 bits, see alignment E=4.7e-219 PF00180: Iso_dh" amino acids 31 to 412 (382 residues), 289.9 bits, see alignment E=1.6e-90

Best Hits

Swiss-Prot: 72% identical to IDH_PSEAB: Isocitrate dehydrogenase [NADP] (icd) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K00031, isocitrate dehydrogenase [EC: 1.1.1.42] (inferred from 100% identity to hse:Hsero_1396)

MetaCyc: 71% identical to isocitrate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Isocitrate dehydrogenase (NADP(+)). [EC: 1.1.1.42]

Predicted SEED Role

"Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)" in subsystem TCA Cycle (EC 1.1.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.42

Use Curated BLAST to search for 1.1.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IP92 at UniProt or InterPro

Protein Sequence (418 amino acids)

>HSERO_RS07015 isocitrate dehydrogenase (Herbaspirillum seropedicae SmR1)
MSYQHIQVPAEGRKITANADDTLNVPNNPIIPYIVGDGVGVDVTPVMLKVVNAAVEKAYG
GARKIHWMEIYAGEKATRLYGPDVWLPEETLAVLKKYLVAIKGPLSTPVGGGIRSLNVAM
RQQLDLYVCLRPVRYFKGVPSPLREPEKTDMVIFRENSEDIYAGIEWAAGTPEVNKLIDL
LTREMGVKKLRFPESSALGIKPVSREGTERLVRQAIQYAIDHDKPSVTLVHKGNIMKFTE
GAFRDWGYALAAREFGAELIDDGPWMRLKNPKTGRAIIIKDAITDAFFQQVLMRPAEYSV
IATLNLNGDYISDAVAAQVGGIGIAPGANMSDSVAVFEATHGTAPKYAGKDYVNPGSSIL
SAEMMLRHMGWIEAADLIISAMQKSVSSKRVTYDFARLLEGATQVSCSGFGEVMIENM