Protein Info for HSERO_RS06820 in Herbaspirillum seropedicae SmR1

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 5 to 466 (462 residues), 429 bits, see alignment E=1.1e-132 PF02321: OEP" amino acids 61 to 251 (191 residues), 85.1 bits, see alignment E=2.8e-28 amino acids 284 to 464 (181 residues), 112.5 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 51% identical to SEPC_PSEP1: Probable efflux pump outer membrane protein SepC (sepC) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1359)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IP55 at UniProt or InterPro

Protein Sequence (484 amino acids)

>HSERO_RS06820 multidrug transporter (Herbaspirillum seropedicae SmR1)
MLPVMLAMLLGGCTLMPDYHRPDAPVAAHFAGADSKNAAGASSAPVVADIGWRDVFTDPS
LQQVIALALENNRDLRVAVLNIEKARAQYGVQRAALFPSIKAATSETASRTPGDLSSTGS
ALTSRSYTATLGFSAYELDLFGRVRSLKEQALQSFLSTAEARRSTQISLIAEVATAWLTL
ASDQDRLRLAQDTLESQSSSYALTQRSFELGSSSALTLRQAQTSVESARVDVESYTAQVD
QDRNALVLLVGKDLPTALLPQGLPDTRLAAASPLATIPPGLPSDLLQRRADIVQAERDLR
AANANIGAARAAFYPSITLTVNAGTASARLAGLFKGGSGSWSFVPQISLPIFDGGANQAN
LDIATVSRDISVAQYEKAIQTAFREVSDALAQRNTLGRQLQAQEALVQASDEAFRLSQAR
YHSGVDSYLTVLDSQRTLYSAQKNLIGTQLSRWTNLVTFYKTLGGGWVERTGTPAASDIA
TQEP