Protein Info for HSERO_RS06640 in Herbaspirillum seropedicae SmR1

Annotation: N-carbamoylsarcosine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00857: Isochorismatase" amino acids 25 to 197 (173 residues), 139.3 bits, see alignment E=7.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1326)

MetaCyc: 75% identical to maleamate amidohydrolase (Alcaligenes faecalis)
RXN-646 [EC: 3.5.1.107]

Predicted SEED Role

"N-carbamoylsarcosine amidase (EC 3.5.1.59)" (EC 3.5.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.107 or 3.5.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IP22 at UniProt or InterPro

Protein Sequence (207 amino acids)

>HSERO_RS06640 N-carbamoylsarcosine amidase (Herbaspirillum seropedicae SmR1)
MHKEVETYQRQGFGQTLEMKPPFGLLIVDFVNSFADPQQFGGGNIPQAIERTRSLLAHAR
QQGWPVAHSRIVFADDDADRNIFGMKVPGMVTLKEDLPGSAIVPQLAPANGELVVRKTVP
SAFFGTSLAPWLTQHGVQTLLVAGAVTSGCVRASVVDAMSWGFRPLVVSDCVGDRALGPH
EANLFDMAQKYAAVMPLDEAMQVVGQR