Protein Info for HSERO_RS06640 in Herbaspirillum seropedicae SmR1

Annotation: N-carbamoylsarcosine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 25 to 197 (173 residues), 139.3 bits, E=7.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1326)

MetaCyc: 75% identical to maleamate amidohydrolase (Alcaligenes faecalis)
RXN-646 [EC: 3.5.1.107]

Predicted SEED Role

"N-carbamoylsarcosine amidase (EC 3.5.1.59)" (EC 3.5.1.59)

MetaCyc Pathways

• nicotinate degradation I (6/6 steps found)
• picolinate degradation (4/7 steps found)
• creatinine degradation II (2/5 steps found)
• nicotinate degradation II (2/5 steps found)
• nicotine degradation III (VPP pathway) (5/10 steps found)
• nicotine degradation II (pyrrolidine pathway) (5/11 steps found)
• superpathway of nicotinate degradation (7/18 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.107 or 3.5.1.59

Sequence Analysis Tools

See D8IP22 at UniProt or InterPro

Protein Sequence (207 amino acids)

>HSERO_RS06640 N-carbamoylsarcosine amidase (Herbaspirillum seropedicae SmR1)
MHKEVETYQRQGFGQTLEMKPPFGLLIVDFVNSFADPQQFGGGNIPQAIERTRSLLAHAR
QQGWPVAHSRIVFADDDADRNIFGMKVPGMVTLKEDLPGSAIVPQLAPANGELVVRKTVP
SAFFGTSLAPWLTQHGVQTLLVAGAVTSGCVRASVVDAMSWGFRPLVVSDCVGDRALGPH
EANLFDMAQKYAAVMPLDEAMQVVGQR