Protein Info for HSERO_RS06630 in Herbaspirillum seropedicae SmR1

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF12146: Hydrolase_4" amino acids 35 to 256 (222 residues), 39.6 bits, see alignment E=5.8e-14 PF00561: Abhydrolase_1" amino acids 38 to 261 (224 residues), 77.1 bits, see alignment E=2.6e-25 PF12697: Abhydrolase_6" amino acids 39 to 265 (227 residues), 65 bits, see alignment E=2.5e-21

Best Hits

Swiss-Prot: 64% identical to NICD_PSEPK: N-formylmaleamate deformylase (nicD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1324)

MetaCyc: 72% identical to N-formylmaleamate deformylase (Alcaligenes faecalis)
RXN-11318 [EC: 3.5.1.106]

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IP20 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HSERO_RS06630 alpha/beta hydrolase (Herbaspirillum seropedicae SmR1)
MHSHSSSFLYGANVQANGIRQHYLRYGGNDGARASRDAVIILPGITSPAVTWGFVGERFG
QQFDTYVLDVRGRGLSSASDTLDYSVDAQAADVIALAQALGLSRYAIVGHSMGARIGARA
ARQTPQGLTRLVMVDPPVSGPGRRAYPSKLPWYVDSMRLARAGCSAEQMRAFCATWTEEQ
LQLRAEWLHTCDERAVIASFEEFHTGDFHADLPALRLPVMLMQASRGDVILPEDVAEIRS
LLPQVVVSRVEEAGHMIPWDNEAGFYAAFRDFLGATL