Protein Info for HSERO_RS06355 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): 2,4-diketo-3-deoxy-L-fuconate hydrolase (EC 3.7.1.26)
Rationale: Specifically important for utilization of L-fucose, L-rhamnose, D-ribose, and D-xylose. The substrate is also known as 2,4-didehydro-3-deoxy-L-rhamnonate. This reaction is part of fucose or rhamonase oxidation. The phenotypes on ribose or xylose are not explained.
Original annotation: ureidoglycolate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to UGL_BURCA: Ureidoglycolate lyase (Bcen_5340) from Burkholderia cenocepacia (strain AU 1054)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1264)

MetaCyc: 95% identical to 5-hydroxy-2,4-dioxopentanoate hydrolase (Herbaspirillum huttiense)
RXN-12096 [EC: 3.7.1.26]; 3.7.1.26 [EC: 3.7.1.26]

Predicted SEED Role

"2,4-diketo-3-deoxy-L-fuconate hydrolase" in subsystem L-fucose utilization temp

MetaCyc Pathways

L-fucose degradation III (8/8 steps found)
L-arabinose degradation V (5/6 steps found)
D-arabinose degradation IV (4/6 steps found)
D-xylose degradation VI (3/5 steps found)
L-rhamnose degradation III (3/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INW0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>HSERO_RS06355 2,4-diketo-3-deoxy-L-fuconate hydrolase (EC 3.7.1.26) (Herbaspirillum seropedicae SmR1)
MKLLRYGPVGQEKPGILDQAGKIRDLSAHIKDVNGAVLDDASLEKIRKLDLNTLPVVEGN
PRIGACVGNIGKFICIGLNYADHAAESNLPIPAEPVVFNKWTSAVVGPNDNVKIPRGSKK
TDWEVELGVIIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIERGGTWDKGKGCDTFGP
IGPWLVTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFNVAHIVSYLSRFMSLQPGDVIS
TGTPPGVGMGVKPEAVYLRAGQTIRLGIDGLGEQEQKTIDA