Protein Info for HSERO_RS06340 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 23 (4 residues), see Phobius details amino acids 28 to 29 (2 residues), see Phobius details amino acids 32 to 54 (23 residues), see Phobius details PF11808: PhoR" amino acids 11 to 93 (83 residues), 73.5 bits, see alignment E=3.7e-24 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 99 to 423 (325 residues), 404 bits, see alignment E=2.2e-125 PF13188: PAS_8" amino acids 101 to 150 (50 residues), 29.4 bits, see alignment 1.4e-10 PF00512: HisKA" amino acids 205 to 271 (67 residues), 65.1 bits, see alignment E=1.2e-21 PF02518: HATPase_c" amino acids 316 to 426 (111 residues), 98.3 bits, see alignment E=9.4e-32

Best Hits

Swiss-Prot: 42% identical to PHOR_ECOLI: Phosphate regulon sensor protein PhoR (phoR) from Escherichia coli (strain K12)

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to hse:Hsero_1261)

MetaCyc: 42% identical to sensor histidine kinase PhoR (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INV7 at UniProt or InterPro

Protein Sequence (436 amino acids)

>HSERO_RS06340 histidine kinase (Herbaspirillum seropedicae SmR1)
MSPQLLFWIPAVLRLVLCLAGAGVVGFFFGPIAGLVTAVLGVGAMMITHLHYLLRLSTWL
DDSGQSRLPDGWGAWTDVYARLYRMRRDDEKNQAELAEWLARFRQAMSLLPDGVVIMDDV
LFLEWCNPAAQQHLGLKLDRDKGMRVTNLIRNPAFIDYIILGRYEQPLTMTLHERKLIIQ
IIPFENRRQILVTHDVTESERIDMMRRDFVANASHELRTPLTVINGFLEIALAQPNLEEG
TRMAHLKLMTEQGQRMQNLIDDMLTLTRLESIDYPLRTEVLRVRPLLERIAEEGRALSAG
KHEIVLTIDGPDLKGNAEELRSAFTNLVTNAVRYTPEGGRISLRWQSDEQGAHFAVQDTG
IGISPEHISRLTERFYRVDKSRSRETQGTGLGLAIVRHVLLRHHATLEIASVPDHGSTFT
VHFPSTQTIQDYAQTP