Protein Info for HSERO_RS06170 in Herbaspirillum seropedicae SmR1

Annotation: S-adenosylmethionine tRNA ribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 299 to 316 (18 residues), see Phobius details TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 3 to 335 (333 residues), 438.7 bits, see alignment E=6.9e-136 PF02547: Queuosine_synth" amino acids 4 to 335 (332 residues), 450.9 bits, see alignment E=1.3e-139

Best Hits

Swiss-Prot: 78% identical to QUEA_HERAR: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Herminiimonas arsenicoxydans

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 100% identity to hse:Hsero_1228)

MetaCyc: 56% identical to tRNA preQ134 S-adenosylmethionine ribosyltransferase-isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-1342 [EC: 2.4.99.17]

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 2.4.99.17 or 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INS4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>HSERO_RS06170 S-adenosylmethionine tRNA ribosyltransferase (Herbaspirillum seropedicae SmR1)
MYSLSDFDFELPPELIAQTPLAERSASRLLQVQGAQLTDRRFSDIVDLLQAGDLLVFNDT
RVIKARLFGVKETGGKIEALVERILDPRTVHAQVRASKSPPPGTRIRLADAFEVTVGERF
GEFYTLHFPEDAFALLEQYGSLPLPPYIDHEADAYDETRYQTVYAKEPGAVAAPTAGLHF
DQALLEQLAARGVQQAFVTLHVGAGTFQPVRVEDLSQHKMHSEWYTIPPETVEAVRAAKA
AGRRVIAVGTTSMRALESGSQSGALKAGSDDTQLFITPGYTFKTVDQLVTNFHLPKSTLL
MLVSAFAGYELIRAAYAHAIAQKYRFFSYGDAMLLTRT