Protein Info for HSERO_RS06165 in Herbaspirillum seropedicae SmR1

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 PF17191: RecG_wedge" amino acids 29 to 181 (153 residues), 43.9 bits, see alignment E=6e-15 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 38 to 676 (639 residues), 708.8 bits, see alignment E=3.8e-217 PF01336: tRNA_anti-codon" amino acids 73 to 147 (75 residues), 32.5 bits, see alignment E=2.1e-11 PF04851: ResIII" amino acids 276 to 443 (168 residues), 39.6 bits, see alignment E=1.5e-13 PF00270: DEAD" amino acids 281 to 449 (169 residues), 89.8 bits, see alignment E=5.1e-29 PF00271: Helicase_C" amino acids 492 to 599 (108 residues), 59.9 bits, see alignment E=8.2e-20 PF19833: RecG_dom3_C" amino acids 628 to 688 (61 residues), 44.2 bits, see alignment 5e-15

Best Hits

Swiss-Prot: 50% identical to RECG_ECO57: ATP-dependent DNA helicase RecG (recG) from Escherichia coli O157:H7

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to hse:Hsero_1227)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INS3 at UniProt or InterPro

Protein Sequence (705 amino acids)

>HSERO_RS06165 ATP-dependent DNA helicase RecG (Herbaspirillum seropedicae SmR1)
MPATAKKTSPPAPKKKATAAKSAAKPAAKPENKLAKLGLHNDMDLVLHLPLRYEDETSLM
SIAEASMRGLQTVQVEGVVSSCEVQFRPRRQLIVTVGDDSGQLTLRFLNFYGSQTKQMAE
GTRLRVRGELRHGFFGAEMVHPSYKVVNEGAPLPDVLTPVYPAGEGLSQAYLRKAIANAM
SRLDWSDTLPPSMLATLNLAAFEPSVRLLHNPPPDVDEHALIEKSHPAWIRMKFDELLAQ
QLSLKRAQAARRAKSARALPVTGRITEELTRLLPFQLTGAQQRVLEEIRADLRQSFPMQR
LLQGDVGSGKTVVAALAAAQAIDSGCQAVLMAPTEILAEQHFRKIAAWMEPLDVGVAWLS
GSQKKKEKTEALAHIESGAARLVIGTHALIQDTVQFENLGLVIVDEQHRFGVGQRLALRN
KSFNPADHDSPAVPHQLMMSATPIPRTLAMTYYADLEVSVIDELPPGRSPIVTRVIDQNR
RDEVIERVHAAALEGKQIYWVCPLIEESEALQLQTATDTHAALSAALPDLQIGLVHGRMK
PVEKQMVMEGFSRGAIHLLVATTVIEVGVDVPNASLMVIEHAERFGLSQLHQLRGRVGRG
SAASVCLLLYQGPLGGTAKQRLATMRETTDGFEIARRDLDIRGPGEFLGARQSGEAMLRF
ADLATDQWLVEKARDTAQALLQHAPDIVDRHLARWLGGREDYLKV