Protein Info for HSERO_RS06140 in Herbaspirillum seropedicae SmR1

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF00464: SHMT" amino acids 8 to 383 (376 residues), 570.3 bits, see alignment E=2.8e-175 PF00155: Aminotran_1_2" amino acids 65 to 323 (259 residues), 40.4 bits, see alignment E=3.3e-14 PF00266: Aminotran_5" amino acids 139 to 251 (113 residues), 23.7 bits, see alignment E=3.5e-09

Best Hits

Swiss-Prot: 90% identical to GLYA_HERAR: Serine hydroxymethyltransferase (glyA) from Herminiimonas arsenicoxydans

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to hse:Hsero_1223)

MetaCyc: 62% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INR9 at UniProt or InterPro

Protein Sequence (414 amino acids)

>HSERO_RS06140 serine hydroxymethyltransferase (Herbaspirillum seropedicae SmR1)
MFDKNQTLAKVDPDLWSAIQKENARQQDHIELIASENYTSPAVMEAQGSQLTNKYAEGYP
GKRYYGGCEYVDVAEQLAIDRLKALFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMS
LAEGGHLTHGMALNMSGKWFNVVSYGLNDKEEIDYEAMERLAREKKPKLIIAGASAYSLR
IDFERFAKIAKEVGAYFMVDMAHYAGLIAAGVYPNPVPFADFVTSTTHKSLRGPRGGVIL
MKAEHEKAINSAIFPGIQGGPLMHVIAAKAVAFKEAASPEFKAYQQQVVKNADVLAKTLI
KRGLRIVSGGTESHVMLVDLRPKGLTGKEAEAILGSAHMTCNKNGIPNDPEKPFVTSGIR
LGSPAMTTRGFKEAEAEKVGNFIADVLDNPHDAATIERVKAEVKKLTDAFPVYG