Protein Info for HSERO_RS06125 in Herbaspirillum seropedicae SmR1

Annotation: protein tolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 8 to 231 (224 residues), 281.1 bits, see alignment E=3.2e-88 PF01618: MotA_ExbB" amino acids 100 to 219 (120 residues), 132.3 bits, see alignment E=4.5e-43

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 100% identity to hse:Hsero_1220)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INR6 at UniProt or InterPro

Protein Sequence (234 amino acids)

>HSERO_RS06125 protein tolQ (Herbaspirillum seropedicae SmR1)
MNVTQDLSFISLIANASVLVQLVMLLLLSASIISWTYIFRKMFTIRAARVQTEEFERVFW
SGGNLSALYQDALSNRRKAGGAGGALERIFQAGMGEFTKAKASVAARGGAVDPSLLLDGA
RRAMRAAYQREMDALESHLAFLASVGSVSPYVGLFGTVWGIMNAFRGLANVQQATLAAVA
PGIAEALIATAIGLFAAIPAVVAYNRYSHDIDRLAIRFESFIEEFSNILQRQAR