Protein Info for HSERO_RS06115 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details TIGR02794: protein TolA" amino acids 17 to 310 (294 residues), 111.7 bits, see alignment E=4.6e-36 PF13103: TonB_2" amino acids 231 to 312 (82 residues), 59.7 bits, see alignment E=2.5e-20 TIGR01352: TonB family C-terminal domain" amino acids 261 to 306 (46 residues), 30.2 bits, see alignment 4.5e-11 PF03544: TonB_C" amino acids 261 to 311 (51 residues), 26.6 bits, see alignment 6.8e-10

Best Hits

KEGG orthology group: K03646, colicin import membrane protein (inferred from 100% identity to hse:Hsero_1218)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INR4 at UniProt or InterPro

Protein Sequence (318 amino acids)

>HSERO_RS06115 membrane protein TolA (Herbaspirillum seropedicae SmR1)
MSDNAPYNIPKAPGRWRAITLALVMHVALFLFFWIGIRWQSETPLTVEAEIWDPQYKEAA
PLPTPPEPQPQPVVEPPKPQPQPEPKPVPPKVIDEPKVEKPDIALQKEKERKRKEEQEKQ
EKLEKEKAEKLKAEKEKAEKEKAEREKKEKLEADKQKKLKEEKQKEDEAKKKADAEKQAA
DKKKQQQAAADAKAAEARRQEDLKRMMGQATSATGGTGTAEKSQGPKGSPNYANKLRAKI
RSNTVFDNSGVSGNPAGEYTVELFPDGTVRSVRVNKPSGVPGFDEAVRTAVMKSQPFPPD
TDNKVPSSFTFTHYPKDQ