Protein Info for HSERO_RS06060 in Herbaspirillum seropedicae SmR1

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 53 to 74 (22 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 228 to 233 (6 residues), see Phobius details amino acids 236 to 236 (1 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 97 to 293 (197 residues), 252.3 bits, see alignment E=1.6e-79 PF00528: BPD_transp_1" amino acids 131 to 298 (168 residues), 83.2 bits, see alignment E=9.8e-28

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_1208)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1V4 at UniProt or InterPro

Protein Sequence (307 amino acids)

>HSERO_RS06060 nitrate ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSAVVESIMGENAKPAGPAGSHPPAAVNSQAPASPPAAIPARRAKKRLASGGLFMRVAPP
LLGLALLVLVWQIIALKTSSFPTPWVTLKEAGVMFADPFYRNSPNDQGIGWNVLASLQRV
GTGFGLAALVGIPLGFAIGRVEFLARMFGPIISLLRPVSPLAWLPIGLLVFKSANPAAIW
SIFICSIWPMIINTAVGVQRVPQDYMNVARVLNLSEWKVLTKILFPSVLPYMLTGVRLSI
GTAWLVIVAAEMLTGGVGIGFWVWDEWNNLNVPHIIIAIVVIGVVGLVLEQLLVALAKAF
TYEQVNN