Protein Info for HSERO_RS05945 in Herbaspirillum seropedicae SmR1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF20582: UPF0758_N" amino acids 3 to 78 (76 residues), 82.5 bits, see alignment E=1.8e-27 TIGR00608: DNA repair protein RadC" amino acids 11 to 223 (213 residues), 225.6 bits, see alignment E=3.1e-71 PF04002: RadC" amino acids 104 to 222 (119 residues), 154.1 bits, see alignment E=1.6e-49

Best Hits

Swiss-Prot: 58% identical to Y2468_HERAR: UPF0758 protein HEAR2468 (HEAR2468) from Herminiimonas arsenicoxydans

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to hse:Hsero_1184)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1T0 at UniProt or InterPro

Protein Sequence (224 amino acids)

>HSERO_RS05945 hypothetical protein (Herbaspirillum seropedicae SmR1)
MVITDWPKEQRPRERMAQHGPAALSDAELLAIFLRVGIPGKNAVELASETIQRFGSLDGV
LGAVERDLPLGKGLGPATCTQLRAVLEMSRRAIHTQMRQRELLNSTRAVGDYLKLMLAHR
EQECFVALFLDVRNKLIGTEELFKGTLTQSAVYPREVIKAALRHNAASVILAHNHPSGDP
EPSDHDLRLTAALDEALQMMDIRLLDHFVVAGTRLYSFADHGKM