Protein Info for HSERO_RS05930 in Herbaspirillum seropedicae SmR1

Annotation: aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 19 to 221 (203 residues), 56.9 bits, see alignment E=2.9e-19 PF01610: DDE_Tnp_ISL3" amino acids 275 to 397 (123 residues), 44.7 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 100% identity to hse:Hsero_1181)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1S7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>HSERO_RS05930 aminotransferase (Herbaspirillum seropedicae SmR1)
MTLDAILDFVANGLLHASGWQIVIYTLVMTHITIVGVTLYLHRCQAHRALELHAIPSHFF
RLWLWMTTGMVTKQWAAIHRKHHAKCETEEDPHSPQTRGIKKVMWEGAELYRAESKNDET
MEKFGHGTPDDWLEHNVYSKYSWQGVGLMLIIDVLLFGAIGLTIWAVQMAWIPFWAAGVV
NGLGHFWGYRNYDCVDASTNLFPIGILIGGEEMHNNHHTFGTSAKFSAKWYEFDVGWMYI
RILETFGLAKVKKVLPVPKFDRQKAVIDFETLQSVIANRYDVTAKYARSLKSAWKDELDH
LIEKAKLESRFLKSSKKLLQREPGRLEDGQKQQLSELFAHSKALQTMHEMRIELSAIWER
SHSTREQLLQQLQDWCARAEASGVKALRDFALRLRSYA