Protein Info for HSERO_RS05845 in Herbaspirillum seropedicae SmR1

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 81 (79 residues), 115.4 bits, E=1.3e-37
• PF02777: Sod_Fe_C
  • amino acids 89 to 190 (102 residues), 137.3 bits, E=1.7e-44

Best Hits

Swiss-Prot: 82% identical to SODF_BORPE: Superoxide dismutase [Fe] (sodB) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to hse:Hsero_1165)

MetaCyc: 78% identical to superoxide dismutase (Fe) (Burkholderia sp. AK-5)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See D8J1R1 at UniProt or InterPro

Protein Sequence (192 amino acids)

>HSERO_RS05845 superoxide dismutase (Herbaspirillum seropedicae SmR1)
MAHTLPALPYDLDALAPTISKETLEYHYGKHHQTYVTNLNNLIPGTEFENLSLEEIIKKS
SGGIFNNAAQVWNHTFYWNGLTPKGQGAPSGALADAINAKWGSFDAFKAEFTKQGLANFG
SGWTWLVKKADGTLDIVNTTGAGTPLTTDSKPLLTVDVWEHAYYIDYRNARAKYVENYWG
IINWDFVAKNFA