Protein Info for HSERO_RS05720 in Herbaspirillum seropedicae SmR1

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01168: Ala_racemase_N" amino acids 13 to 236 (224 residues), 107.3 bits, see alignment E=1e-34 PF14031: D-ser_dehydrat" amino acids 254 to 360 (107 residues), 86.8 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 69% identical to DTHAD_DELSH: D-threo-3-hydroxyaspartate dehydratase (dthadh) from Delftia sp. (strain HT23)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1140)

MetaCyc: 69% identical to D-threo-3-hydroxyaspartate ammonia-lyase (Delftia sp. HT23)
RXN-11767 [EC: 4.3.1.27]

Predicted SEED Role

"Type III PLP / low-specificity D-threonine aldolase" in subsystem Serine-glyoxylate cycle or Threonine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1N6 at UniProt or InterPro

Protein Sequence (376 amino acids)

>HSERO_RS05720 alanine racemase (Herbaspirillum seropedicae SmR1)
MNLASLPTPAALIDVARMQRNITRMQQRMDALGVRFRPHVKTTKCNEVVQAQLQAGASGI
TVSTLKEAEQFFAAGISDIVYAVGMAPTKLGQALALRRQGCNLKIVADSVVCAEAIVAFG
QAQEECFDVWIEIDVDGHRSGIAPEDATLLAVGNVLHAGGMRIGGVIAHAGSSYDYDNDE
ALIAVAEQERAGCVRAAERLREAGLPCDVVSIGSTPTALRAEHLRGVTEVRAGVYAMFDL
VMHNVGVNTMYEIALSVLTTVIGHQPEKGWAIVDAGWMAMSRDRGTQGRKHDFGYGQVCT
EEGQVLEGYLMSGANQEHGILSRQGTPDAQIAEHLPIGTRLRILPNHACATGAQHQHYHA
IAADGSVATWPRFNGW