Protein Info for HSERO_RS05660 in Herbaspirillum seropedicae SmR1

Annotation: N-acetyltransferase GCN5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00583: Acetyltransf_1" amino acids 35 to 131 (97 residues), 35.6 bits, see alignment E=2.1e-12 PF13508: Acetyltransf_7" amino acids 66 to 132 (67 residues), 34.8 bits, see alignment E=3.5e-12 PF13673: Acetyltransf_10" amino acids 79 to 138 (60 residues), 36.1 bits, see alignment E=1.2e-12 PF18014: Acetyltransf_18" amino acids 169 to 281 (113 residues), 77.6 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1128)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1M4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>HSERO_RS05660 N-acetyltransferase GCN5 (Herbaspirillum seropedicae SmR1)
MHTDSTLTAGQAAQTTLRPMRPEDLASCHAMSLHLHWPHRLADWQFHHQVSSSWAVELEQ
PDGARSVAGSGMLCPLGEDYASLGLVIIADALQGRGLGRAMMQRLLQDAGSRNVILNATD
AGRPLYEKLGFAVTDTLSQHQSTTARAQPVLAADARIRPLRKEEAPAFLALDRQASGMDR
STLLQPLLATAEVAVLEQAGQVKGVAMLREFGRGRVIGPVIASQVEDAKALIAHWVHAYP
GAYLRIDVPGRTGLKPWLEEIGLTCVDNVVSMCRGTPPSPATPWRTYSMINQALG