Protein Info for HSERO_RS05580 in Herbaspirillum seropedicae SmR1

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 66 to 463 (398 residues), 315.3 bits, see alignment E=4.1e-98 PF13091: PLDc_2" amino acids 112 to 220 (109 residues), 43 bits, see alignment E=4e-15 amino acids 313 to 439 (127 residues), 115.1 bits, see alignment E=2.1e-37 PF00614: PLDc" amino acids 199 to 223 (25 residues), 24.7 bits, see alignment (E = 1.8e-09)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to hse:Hsero_1112)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1K8 at UniProt or InterPro

Protein Sequence (472 amino acids)

>HSERO_RS05580 cardiolipin synthase (Herbaspirillum seropedicae SmR1)
MTNKNIKPRRWCATLLVLAGLSALLSSCSSLPTIVPDMDTQSARTIQMKGGRGVLSEAQS
KAVLEKLRAQNADNTLLDRHVAIEGAITGSPLVTGNKVTLLIDGPATYASMQQAIQAARY
HINMETYIMEDDEVGRQFADLLIAMQNKGVQVNLMYDSVGALNTPRTFFQPMIDAGIQVL
EYNPLNPTQLRKDWEVNQRDHRKLLVVDGKTAFVGGINISSVYSSGSFSTRKKKPRVNAE
GEQIPWRDTQVRIDGPVALEFQKLFVDTWNKQRGPALGDHRYFPTVAPAGNEIVRAIGSS
PDDPYSVIYATFISAIQHAEKAIYLTNAYFVPDPQLRDSLKDAARRGVDVRLILPSHSDS
SLVLYASRSFYQELLEAGIRIYERQDALLHSKTALIDGVWSTIGSTNLDWRSFVYNQEIN
AVILSPQFGVQMKSMFDRDLGASKEITKEQWEQRPISERMKEFGASVWARLL