Protein Info for HSERO_RS05555 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 24 to 52 (29 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 200 to 231 (32 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 433 to 453 (21 residues), see Phobius details amino acids 465 to 489 (25 residues), see Phobius details amino acids 510 to 541 (32 residues), see Phobius details amino acids 553 to 575 (23 residues), see Phobius details amino acids 593 to 615 (23 residues), see Phobius details PF04290: DctQ" amino acids 40 to 165 (126 residues), 88.9 bits, see alignment E=2.6e-29 PF06808: DctM" amino acids 207 to 613 (407 residues), 352.5 bits, see alignment E=3.1e-109 TIGR00786: TRAP transporter, DctM subunit" amino acids 215 to 614 (400 residues), 289.5 bits, see alignment E=1.9e-90

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1107)

Predicted SEED Role

"Predicted gluconate TRAP family transporter, DctM subunit" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1K3 at UniProt or InterPro

Protein Sequence (618 amino acids)

>HSERO_RS05555 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSALSLEQPVADERSLAARLEHWLGLAIEIPAAALVVGEVAVLLAGVIMRFIFNNPIPWA
DELASILFLWLANLGAAVALRRGTHMRTTVLVGFMSERGKAWAEALAIIAPCVMLLILMH
PMWEYAEDEMFVQTPALGWPNTVRAAAVAVGAALMIALSLLRISRQKLVDLVGVLALLAV
VAGAMYLGAAWLQAIGNWNLVVFFGLVLAVSVLLGIPIAFCFGLATVAFMLTVTTSPLAV
VAGRFDEGMSSLILLAVPLFILLGHLVEMTGMAKAMVDFLASLLGHVRGGLNYVLLGAML
LVSGISGAKTADMAAVAPVLLPEMKRRGNHEGELISLLAASGAMAETIPPSLVLITIGSV
AGVSIAALFTGGIMPGIVLAVLLAILARWRSAEIMEGIQRAPGRVVLRTLIIALPALLLP
ILIRTAVVEGVATATEVSTIGIAYSVVAGLLVYRKFDWKRLYPMLVDTAALSGAILFIIG
TATGMSWALTQSGFSHALAEAMTSVPGGKYGFLLVSIAAFIVLGSVLEGIPAMVLFAPLL
FPVAKAIGVHEVHYAMVIILSMGVGLFAPPFGLGYYAACTIGRVHPDVAVKRIWPYLGAL
VVGLLIVAFVPWFSIGFL