Protein Info for HSERO_RS05540 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome C'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00034: Cytochrom_C" amino acids 24 to 104 (81 residues), 41.5 bits, see alignment E=2.8e-14 PF13442: Cytochrome_CBB3" amino acids 24 to 100 (77 residues), 31.6 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 48% identical to CY552_HYDTT: Cytochrome c-552 (HTH_0988) from Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1104)

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1K0 at UniProt or InterPro

Protein Sequence (104 amino acids)

>HSERO_RS05540 cytochrome C' (Herbaspirillum seropedicae SmR1)
MKYLLLIATLVAGSAISAEAMANAQLAKSKNCMACHSVDAKIVGPAFKEVAKKYAGQKDA
EAKLTQKVLNGGGGVWGAVPMPANKGQVSEAEARELVKWVLTLK