Protein Info for HSERO_RS05325 in Herbaspirillum seropedicae SmR1

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 265 to 295 (31 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 320 (264 residues), 159.4 bits, see alignment E=5.1e-51

Best Hits

Swiss-Prot: 49% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to hse:Hsero_1064)

MetaCyc: 39% identical to putative erythritol ABC transporter membrane protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J126 at UniProt or InterPro

Protein Sequence (328 amino acids)

>HSERO_RS05325 ribose ABC transporter permease (Herbaspirillum seropedicae SmR1)
MPHDANALPAASLHTAASARWRSLIHSPLALPLAGLVVVSLLMGLASDNFFTLSNWFNVL
RQVSIVGILAVGMSFVILTGGIDLSVGAAMALAGTISAGLIVNSGLPAPLALLCGVGLAT
CIGLLNGALVAWGRMPAIIVTLATMGVARGVGLIYSGGYPISGLPGWISWFGVGRIGMVP
VPVILMLIVYALAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYAISGFTSGL
AAIILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLLGILNNGLN
LMGINPYLQDIIRGVIILLAIYIAREWR