Protein Info for HSERO_RS05190 in Herbaspirillum seropedicae SmR1

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 33 to 310 (278 residues), 206 bits, see alignment E=7.9e-65 PF00532: Peripla_BP_1" amino acids 49 to 148 (100 residues), 27.7 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 78% identical to CHVE_AGRFC: Multiple sugar-binding periplasmic receptor ChvE (chvE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10546, putative multiple sugar transport system substrate-binding protein (inferred from 100% identity to hse:Hsero_1037)

Predicted SEED Role

"L-arabinose-binding periplasmic protein precursor AraF (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0Z9 at UniProt or InterPro

Protein Sequence (357 amino acids)

>HSERO_RS05190 sugar ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
MKIKSVLSGIALGLGVTLMSISAQVSAQSKQLVGVAMPTKSSARWIADGNNMVKVLKEKG
YQTDLQYAEDDIPNQLSQIENMLTKGAKVLVIAAIDGTTLTDVLQKAADKGVKVIAYDRL
IRGSKNVDYYATFDNFQVGVLQAQSLEKALGLKEGKGPFNIELFGGSSDDNNAFFFYNGA
MSVLKPYIDSGKLVVRSKQMGMDKVATLRWDPATAQARMDNLLSAYYTNAKVNAVLSPYD
GLSIGILSSLRGVGYGTPQQPFPYVSGQDAEVPSVKSIIRGEQYSTIFKDTRELAKVTVG
MVDAVLGGKQPQINDTKTYNNGVKVVPSYLLKPVVVDKSNWKEVLVGSGYYTEAQLK