Protein Info for HSERO_RS05105 in Herbaspirillum seropedicae SmR1

Annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF00294: PfkB" amino acids 9 to 301 (293 residues), 222.2 bits, see alignment E=1e-69 TIGR02152: ribokinase" amino acids 10 to 304 (295 residues), 310 bits, see alignment E=8.6e-97 PF08543: Phos_pyr_kin" amino acids 172 to 285 (114 residues), 43.8 bits, see alignment E=2.1e-15

Best Hits

Swiss-Prot: 39% identical to RBSK_HAEIN: Ribokinase (rbsK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to hse:Hsero_1020)

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.15

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0Y2 at UniProt or InterPro

Protein Sequence (319 amino acids)

>HSERO_RS05105 ribokinase (Herbaspirillum seropedicae SmR1)
MTSFPHKQGVAVLGIYVADLAFRAPNMPGLGQTIAGTGFAMGPGGKGSNQAVAAARVGAP
VRFISAIGKDAFGDFALSLWRRETIAPHVRVIDGAPTGAAFIYVNDASGDNAIIVVPGAA
SQLSEQDVERERQAIEAAKVFVTQLEQPPEAALAGLQIARAAGTTTVFNPAPALAFPAQV
YGLCDFITPNEHEAALLTGIEIHHIDDARRAADVLLERGVGCALITLGAQGSLLHSRSQS
LHLPALCAGTVVETAGAGDAFNGAFAAGLAEGMSAEEAARLATAVAAISVTRPGTAPSMP
SRQEALALLDTHASVLAQA