Protein Info for HSERO_RS04850 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00005: ABC_tran" amino acids 25 to 168 (144 residues), 90.6 bits, see alignment E=2.2e-29 PF17912: OB_MalK" amino acids 242 to 289 (48 residues), 40.7 bits, see alignment 5.5e-14 PF08402: TOBE_2" amino acids 284 to 331 (48 residues), 23.2 bits, see alignment 9.2e-09

Best Hits

Swiss-Prot: 36% identical to UGPC1_RHIL3: sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 (ugpC1) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to hse:Hsero_0968)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0T0 at UniProt or InterPro

Protein Sequence (362 amino acids)

>HSERO_RS04850 ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MARIEFKNLGHAYSGNPASLKDYALQPMNMVWEDGGAYALLGPSGCGKSTLLNIISGLLQ
PSEGQVLFDGRDMTRMATRDRNIAQVFQFPVLYDTMSVFDNLAFPLRNRKIAEREVQARV
REIAEMLDLTRDLKQRAAGLSADAKQKISLGRGLVRKDVAAILFDEPLTVIDPHMKWELR
QKLKEIHHQLKLTLIYVTHDQVEALTFADEVVVMTEGKVVQQGKPEALFLRPDHTFVGYF
IGSPGMNFCPVRLEGDAVLLGQQRLQIEAAQLQALKNSNGELKLGIRPEFVELAAPGATG
AVSAEITQVQHLGTSQLVTAQFEGMSVKARLSPEMKIATGNQWLRLAKPETIYFSNDERI
GR