Protein Info for HSERO_RS04275 in Herbaspirillum seropedicae SmR1

Annotation: glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 113 to 139 (27 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 3 to 198 (196 residues), 189.8 bits, see alignment E=2.3e-60 PF02660: G3P_acyltransf" amino acids 10 to 189 (180 residues), 178.2 bits, see alignment E=7.2e-57

Best Hits

Swiss-Prot: 79% identical to PLSY_JANMA: Glycerol-3-phosphate acyltransferase (plsY) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to hse:Hsero_0851)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J032 at UniProt or InterPro

Protein Sequence (205 amino acids)

>HSERO_RS04275 glycerol-3-phosphate acyltransferase (Herbaspirillum seropedicae SmR1)
MYNILFAIGAYLIGSLSFAVLVSKLFGLSDPRTYGSKNPGATNVLRSGNKKAAALTLLGD
GFKGWLAVWLAQKFGPHYGVDDTGIALVTLAVFLGHLWPVFFRFVGGKGVATALGILLAL
DIWLGLATLATWLAVAFAFRYSSLAALVAALFAPFYYGLLFGTTDGILLAVVAMAALLIY
RHRKNIGNLLAGKESRIGDKKKAGK