Protein Info for HSERO_RS04190 in Herbaspirillum seropedicae SmR1

Annotation: DNA mismatch repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 TIGR00585: DNA mismatch repair protein MutL" amino acids 20 to 321 (302 residues), 317.7 bits, see alignment E=5.5e-99 PF02518: HATPase_c" amino acids 40 to 95 (56 residues), 40 bits, see alignment 9.7e-14 PF13589: HATPase_c_3" amino acids 43 to 135 (93 residues), 48.1 bits, see alignment E=2.5e-16 PF01119: DNA_mis_repair" amino acids 224 to 340 (117 residues), 134.2 bits, see alignment E=3.5e-43 PF08676: MutL_C" amino acids 455 to 597 (143 residues), 160.3 bits, see alignment E=5.2e-51

Best Hits

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to hse:Hsero_0834)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J015 at UniProt or InterPro

Protein Sequence (641 amino acids)

>HSERO_RS04190 DNA mismatch repair protein (Herbaspirillum seropedicae SmR1)
MNAPHSPSASDPTAMPSYRPIQALPDQLISQIAAGEVIERPSAVVKELLENALDAGSTQI
TVRLEQGGVKRIAITDNGRGIPPEQLPLALARHATSKIASLTDLENVSTLGFRGEALASI
ASVAQLTVTSRTADAPHAWEITGSQFGTVAPASGAQGTTIDVQDLYFNTPARRKFLKSEQ
TEYGHCAEVVRRIALARPDVSFSLSHNGKTVDHWNVGEFAKRSAHILGDEFANARLPLDE
SAGPLRLHGFVGLPTASKARADGQYFYVNGRFVRDKLLTHAVRAAYQDVLHGDRYPAYAL
SLTLDPALVDVNVHPSKIEVRFRDSRAVHQFVFHAVSRALAQTSAVSFGNLPGAAPQSDD
SAGAPPPAANAPLPWIGEQQQQSFSAQFAEAPRPFSFGGNSGFGVRQNTEAYGSMFRSAP
TSGEPDGSAPAAYGATPAAAPAALPEGDFPLGFALAQLHGIYVLAQNQAGLVVVDMHAAH
ERILYEQLKTALDGNEMFVQPLLIPVTFYADPVEVGTVEEHQETLSALGFDIAVMSPTTL
AVRAVPALLKNADAQTLARDVLRDVREYGGSRVLLERRNELLGTLACHTAVRANRSLTLP
EMNALLRQMEATERSDQCNHGRPTWTQMGLSDLDKLFLRGQ