Protein Info for HSERO_RS03730 in Herbaspirillum seropedicae SmR1

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 893 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 881 (870 residues), 1293.5 bits, see alignment E=0 PF02861: Clp_N" amino acids 23 to 74 (52 residues), 32.6 bits, see alignment 3.6e-11 PF00004: AAA" amino acids 238 to 369 (132 residues), 37.9 bits, see alignment E=1.2e-12 amino acids 628 to 746 (119 residues), 29.3 bits, see alignment E=5.2e-10 PF17871: AAA_lid_9" amino acids 378 to 474 (97 residues), 103.8 bits, see alignment E=2.2e-33 PF07724: AAA_2" amino acids 622 to 791 (170 residues), 190.8 bits, see alignment E=9.4e-60 PF07728: AAA_5" amino acids 627 to 750 (124 residues), 40.7 bits, see alignment E=1.2e-13 PF10431: ClpB_D2-small" amino acids 798 to 871 (74 residues), 43.3 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 70% identity to axy:AXYL_05687)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZE6 at UniProt or InterPro

Protein Sequence (893 amino acids)

>HSERO_RS03730 ATPase (Herbaspirillum seropedicae SmR1)
MGINLKSLISKLNDSSRLATERAASLCMARGQYEVDLEHLFLALLENPQTDFSLIVRRSG
ISPDSLQADLEHEISQFKNGNTRTPVLSSHLQTLFEHGWLIASLDGERPSIRSGHLLLAL
LTQTELAQLAYRGSKLFARFKVDELKHDLAKLTEGSVEAPALASASASAAADGQADEQQG
GDPVGEMRAGGRTPALDQYTTNLTQRAREGKIDPVVGRDGEIRQAVDILLRRRQNNPILT
GEAGVGKTAVVEGLALRIAQDDVPQALQGVEIHTLDMGLLQAGASVKGEFENRLKGVIDE
VKKSPHPIILFIDEAHTMIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEK
DAALARRFQVIKVEEPTEEVACAMLRAMAPLMEKHFGVRVYDEAITEAVRLSHRYISGRQ
LPDKAISVLDTACAKVALGQNATPARLEGVTRRLERLAAEIAALERETRSGASHATRLGE
LQAQHAQAIAEQTELQQRWEQERELNGRIQAARAALEEANQESASSQDSAAARSELQQLL
AQLKEHQGETPMVPVQVDGHVVAEIVAGWTGIPLGKMVKDEIKTVLGLDALLKERVLGQP
QATAAVAQRVRTSRANLDDPGKPKGVFLFVGPSGVGKTETALALADVLYGGERKLITINM
SEYQEAHTVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLELFFQVF
DKGVMDDGEGREIDFKNTIIILTSNVASSQLMQACLNKSAAELPTPDELDVLIRPQLVKA
FKPAFLGRLKVIPYYPISDEVLEQIIKLKLGRIANRIAENHKAEFSYDKALVEAVLARCT
EVDSGARNVDNILNGSLLPEIAESVLARMAEGQGISRIKVSAGKKGDFKYTIQ