Protein Info for HSERO_RS03405 in Herbaspirillum seropedicae SmR1

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 3 to 212 (210 residues), 291.8 bits, see alignment E=1.5e-91 PF01243: Putative_PNPOx" amino acids 33 to 119 (87 residues), 94.9 bits, see alignment E=4.1e-31 PF10590: PNP_phzG_C" amino acids 171 to 212 (42 residues), 77.9 bits, see alignment 6.5e-26

Best Hits

Swiss-Prot: 66% identical to PDXH_HERAR: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Herminiimonas arsenicoxydans

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to hse:Hsero_0682)

MetaCyc: 45% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZ81 at UniProt or InterPro

Protein Sequence (212 amino acids)

>HSERO_RS03405 pyridoxamine 5'-phosphate oxidase (Herbaspirillum seropedicae SmR1)
MSSLADLRKDYSRASLSETETAADPIDQFAIWFDEASRAQIPEPNAMSVATVGKDGRPSS
RIVLIKQFDQQGFTWFTNYDSRKGIDVAENPYVALLFHWVELERQVRIEGKIERVSQEES
DAYFYSRPLASQLGAIASQQSRTVESREKLEQQYETTKQQFGEHPSRPEHWGGYRVIPER
IEFWQGRPSRMHDRVLYTRDASGQWQRQRLQP