Protein Info for HSERO_RS03195 in Herbaspirillum seropedicae SmR1

Annotation: poly(3-hydroxybutyrate) depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01849: polyhydroxyalkanoate depolymerase, intracellular" amino acids 4 to 405 (402 residues), 519.6 bits, see alignment E=2.5e-160 PF06850: PHB_depo_C" amino acids 205 to 405 (201 residues), 300 bits, see alignment E=3.7e-94

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0639)

Predicted SEED Role

"Poly-beta-hydroxyalkanoate depolymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYJ8 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HSERO_RS03195 poly(3-hydroxybutyrate) depolymerase (Herbaspirillum seropedicae SmR1)
MIPTYQLYQNYADATDPLRACARMMAQALGATWPGIPVHPYWRKMASACEVFARTQLTHA
RPPFGIATVEEEGCTISVHEEEIHATPFCGLLHFRKDSATVQPKVLVVAPMSGHFATLLR
GTVRTLLRDHDVYITDWRNARDVATAHGRFGLDEYVSHIIDFLGVLGPGAHLLAVCQPTV
AALTAAAVMAADGHPAQPRSMTLMAGPIDTRVNPTAVNALAKSKPIAWFEKNMISTVPAR
HAGAGRRVYPGFVQLAAFMNMNLSRHVEAFGKLYHHLVDGEHARADQIKDFYEEYFAMAD
LPAEFYLETVRTVFQEHALPLGKLSYAGRPVEPRAIRRTALFTIEGEKDDICAVGQTLAA
QELCSGIRPYMRLHHVQTAVGHYGVFNGRRWDNEIYPRLRDFINMHHR