Protein Info for HSERO_RS02910 in Herbaspirillum seropedicae SmR1

Annotation: IclR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF09339: HTH_IclR" amino acids 24 to 69 (46 residues), 46.4 bits, see alignment 4e-16 PF01614: IclR" amino acids 134 to 256 (123 residues), 100.3 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 31% identical to KDGR_ECOLI: Transcriptional regulator KdgR (kdgR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0581)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYE0 at UniProt or InterPro

Protein Sequence (265 amino acids)

>HSERO_RS02910 IclR family transcriptional regulator (Herbaspirillum seropedicae SmR1)
MPAHALPPDDAARIAGTAAFSKFMVVLQLIADQDAPLNIAQLAALSGYPRPTVYRILAAL
MAEGMVVENPRNKQYEVGPRLINLASRAWDRSDIRTTAIESLRQLRDLTRETVHLAVPSD
HSMVYIEKLESPQAVRMDSRIGTRVTLYSSSVGKAYLAGLEEAHRERLMRTLHLQAFTAN
THTELAALRADVEDTRARGYAEDREENEAQIFCYGAAIVGADGVPVACVSVSIPLYRRLP
DAQQAYVQPLLQACATISRKLAGPG