Protein Info for HSERO_RS02690 in Herbaspirillum seropedicae SmR1

Annotation: taurine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 372 to 401 (30 residues), see Phobius details amino acids 414 to 436 (23 residues), see Phobius details amino acids 445 to 468 (24 residues), see Phobius details amino acids 489 to 511 (23 residues), see Phobius details amino acids 547 to 567 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 258 (174 residues), 51.7 bits, see alignment E=4.6e-18 amino acids 396 to 579 (184 residues), 67.5 bits, see alignment E=6.5e-23

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_0540)

Predicted SEED Role

"ABC-type anion transport system, duplicated permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY99 at UniProt or InterPro

Protein Sequence (581 amino acids)

>HSERO_RS02690 taurine ABC transporter permease (Herbaspirillum seropedicae SmR1)
MKTTSPQLTAYEEVKPGFGWIDALVLAVLFGLLWSALHFGKGMLVHFDPSDQLEVDSSPA
MIPYYAGRTLLRMWIAFAFSLFFAIGTGYLAAKSRRARALILPALDILQSVPVLGFLSAT
VAGFMALFPGSLMGVECAAIFAIFTGQVWNMAFGFYHSMVTIPTDMQEAATTYRLTAWQR
FRTVELPASAHSLIWNSMMSFGGGWFFVAQSEAISVMNKDLKLPGLGSYMAQAIDQGDHT
AALWAVIAMLALILVSDQLVWRPLLAWADKFKIELTESSSPPTSWVYDLLRGSYVFTWLD
EKCWQPLGDWLARHRPGTSAAPTPARITRERWTKRVLTGLICGLLIFEALRGLVAAIDAL
HGAMSWSLFGHIVWLGFLTMLRVLAMTVIATLIWTPVGVWIGSKPHIARFAQPLAQIGAS
FPVNMTFPLVVGWFVAANVSMNWGSILLIAMGTQWYILFNVIAGAMAIPNDLKEAARMYG
LSRWNLWKTLILPAIFPFWVTGACTAAGGAWNASIVAELASWGDVSLKADGLGAYISAVT
KSGDTPLIIASIGVMSMFVVLMNKFVWRRLYAFAERRFRLD