Protein Info for HSERO_RS02655 in Herbaspirillum seropedicae SmR1

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 232 to 257 (26 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 356 (34 residues), see Phobius details PF01594: AI-2E_transport" amino acids 22 to 355 (334 residues), 148.8 bits, see alignment E=1.1e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0533)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY92 at UniProt or InterPro

Protein Sequence (626 amino acids)

>HSERO_RS02655 transporter (Herbaspirillum seropedicae SmR1)
MTIHSKASALSRFNSTTLLGAAVALGMLYFGREILAPLAVAGIASLIILPLVRKLDALGL
NRAGAAIVSVLLVGSCLVALAVVLAFQLVSVTSDLPQYREAIQDKVESVRAMTERPFARL
EAELSAVIPQPVPETTRSGKKASHAAATAPAPAAEADTRMSVRGAIKRLFALAWGPIGQA
GIVLVLLVFILLEQESLRERLIRLAGLTEMSRTMQALGDAAEGVSRFFFSQFLVNLAFGL
IMGAVLAAGGVPHAVLWGTLAGVLRFVPYLGALASGVMIAIFIAAIDPGWWLALSFLAFY
GCLEVIVANFIEPRIYGHSSGLSPLAVIVSALFWGSLWGPIGLLLSTPLTLCLVVAGRHV
AALEPISILLGEAPDMSHAERFYQRALAGESDAIIRDARRHLQKQSFAKYCDQVLLPGLA
LAAVDFREGRIEGPQQNRLLSSISQLTETLMQTPGTPKSLRRRREVPLLNSSVGAHLREL
RQARLGRWQGSLDVPVGSVVLCAGLDHERDDLLCELLVHALRMTGIDARSITLDRPEDEQ
PDSSKAELVSIVFLVYPLRESLARWQEQVRTLRAAIPQALLATIRPSFFSEEVEAGVVKD
QVDMVLSSFEEGLAFAATHMRPELKA