Protein Info for HSERO_RS02630 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details PF02659: Mntp" amino acids 31 to 184 (154 residues), 184.3 bits, see alignment E=6.4e-59

Best Hits

Swiss-Prot: 69% identical to MNTP_PSEU2: Putative manganese efflux pump MntP (mntP) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0528)

MetaCyc: 56% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY87 at UniProt or InterPro

Protein Sequence (193 amino acids)

>HSERO_RS02630 membrane protein (Herbaspirillum seropedicae SmR1)
MNFPALVLLALAMSTDAFAAAIGKGAAMQKPRFLQALRIGLLFGVIEAITPLIGWFAGSV
ATKWVSQWDHWIAFTLLLVLGVRMIREGMSDDDEDEDASAAPQKQSVVMLALTAVATSID
AMAVGVGLAFIDVNILEAALLIGLATTTMVTIGVMVGRVLGHLIGKRAEIIGGVVLIGVG
AAILYEHLSRAGG