Protein Info for HSERO_RS02545 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 52 (23 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details PF03458: Gly_transporter" amino acids 6 to 78 (73 residues), 72.2 bits, see alignment E=1.3e-24 amino acids 91 to 164 (74 residues), 73 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 47% identical to YICG_ECOL6: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0513)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXF7 at UniProt or InterPro

Protein Sequence (208 amino acids)

>HSERO_RS02545 membrane protein (Herbaspirillum seropedicae SmR1)
MLLHTIYLIAICAEAISGALMGIRKDMDIFGVCLIGTVAALGGGTMRDILIGHYPLGWVA
HPEYLAFTICAAVVAAVAARALHHFKSAFLVVDALGLVAFTVIGCDIARGFADFHPAIVV
MLGMVTGVFGGLLRDVLCNEIPLVLRREIYASVSLLTGATYVGVLHLQVDPRIATMSSLL
LGFAVRLLAIRFHWELPRMDKDRVRGFD