Protein Info for HSERO_RS02525 in Herbaspirillum seropedicae SmR1

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 30 to 181 (152 residues), 56.9 bits, E=2.3e-19
• PF07722: Peptidase_C26
  • amino acids 71 to 102 (32 residues), 20.8 bits, 2.9e-08

Best Hits

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to hse:Hsero_0509)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See D8IXF3 at UniProt or InterPro

Protein Sequence (238 amino acids)

>HSERO_RS02525 glutamine amidotransferase (Herbaspirillum seropedicae SmR1)
MKEAIALRHVHFEDVGILDSLLASHGYRLRYIDATIEQADTAAAEQADLLIVLGGPIGAY
DEGLHPFLLRELDLIARRLQQQRPLLGICLGAQLIARALGAEVAPMGLKEIGYAPLDLST
EGRLSPLAALEGQPVLHWHGDQFAIPPGATCLASTPVCPHQAFSLGAHVLALQFHLEADP
ARINQWLVGHACELGQAGIDPRSLREQAKRFGTDLRSAAHAVMSNWLDKLEASQSALS