Protein Info for HSERO_RS02465 in Herbaspirillum seropedicae SmR1

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 19 to 611 (593 residues), 848.1 bits, see alignment E=3.6e-259 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 20 to 468 (449 residues), 530.1 bits, see alignment E=5e-163 PF00270: DEAD" amino acids 33 to 193 (161 residues), 82.4 bits, see alignment E=8.1e-27 PF00271: Helicase_C" amino acids 230 to 336 (107 residues), 70.9 bits, see alignment E=2.7e-23 PF16124: RecQ_Zn_bind" amino acids 348 to 409 (62 residues), 70.4 bits, see alignment E=4.3e-23 PF09382: RQC" amino acids 411 to 523 (113 residues), 123.6 bits, see alignment E=8.8e-40 PF00570: HRDC" amino acids 542 to 609 (68 residues), 84.7 bits, see alignment E=8.7e-28

Best Hits

Swiss-Prot: 52% identical to RECQ_SALTY: ATP-dependent DNA helicase RecQ (recQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to hse:Hsero_0494)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXD9 at UniProt or InterPro

Protein Sequence (618 amino acids)

>HSERO_RS02465 ATP-dependent DNA helicase RecQ (Herbaspirillum seropedicae SmR1)
MVDFDSLPADAPPQERALHVLETVFGYSSFRGHQGEIVQHVAGGGDALVLMPTGGGKSLC
YQVPALLRQGTGVVISPLIALMQDQVDALDEVGVRAAFLNSTQSFDEAMQIERRLRQGDL
DLLYVAPERLMTPRCLDLLESARISLFAIDEAHCVSQWGHDFRPEYIKLSVLHERFPQVP
RIALTATADQQTREEIIHRLQLEDARQFVSSFDRPNIRYQIVEKANGRKQLLDFIKSEHP
EDAGIVYCLSRKKVEETADFLRSEGINALAYHAGMDYAQRTANQARFLREDKIVMVATIA
FGMGIDKPDVRFVCHLDLPKSVEGYYQETGRAGRDGLPADAWMAYGLQDVVQQRRMIDES
DADETFKRVLGTKLNAMLALCETLHCRRVHLLDYFGEKSAPCGNCDTCLTPPVSFDATVE
VQKLLSTVYRVEQRFAPGHVIEVLRGIDGERVKQWRHDQLSVFGVGSDRGEAEWRAILRQ
VIALGLLTVDADNYSALKLTEAARPVLRGEQAVQLRRYQKPEKAKRSSQRSSFVETDLST
EEQALFEKLRWWRVETARAHNVPAYVIFHDATMREIAKARPQSLDDLRHVTGVGEKKLET
YGAQIIALIAEMQAAQSS