Protein Info for HSERO_RS02230 in Herbaspirillum seropedicae SmR1

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 169 to 188 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF13426: PAS_9" amino acids 20 to 110 (91 residues), 43.5 bits, see alignment E=9.9e-15 TIGR00229: PAS domain S-box protein" amino acids 23 to 114 (92 residues), 52.3 bits, see alignment E=3.1e-18 PF00989: PAS" amino acids 24 to 112 (89 residues), 37.3 bits, see alignment E=7.5e-13 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 56.1 bits, see alignment E=1.1e-18 PF00672: HAMP" amino acids 214 to 259 (46 residues), 37.2 bits, see alignment 8.8e-13 PF00015: MCPsignal" amino acids 328 to 482 (155 residues), 174.2 bits, see alignment E=6.8e-55

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 100% identity to hse:Hsero_0448)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX98 at UniProt or InterPro

Protein Sequence (520 amino acids)

>HSERO_RS02230 methyl-accepting chemotaxis protein (Herbaspirillum seropedicae SmR1)
MRMNMPVTGQERLLIDGKAIVSKTDLKGNITYVNPYFIEISGFEENELLGAPQNLIRHPD
MPAEAFADMWATIKGGTPWTGLVKNRSKNGDHYWVRANVTPIRENGQIVGYMSVRTKPER
DAVAGAEKLYASIRRGQAKGIALHRGEVVRTGLAGWLGKLSRMQLNSRLNLSMGIMLAIQ
LAVVVAGMAALHQWWISALAAAAALLSIVQWIALRNALIKPLHQALDITHAITGGDLSVR
IETTRHDELGRLLRSLRQMNVNLTAIIGDVRSNVETITLATREIASGNLDLSRRTEAQAA
NLEETASSMHELASTVRQNADHAVQANDLAGTASAIAMRGGDAVASTGTTMNEISESSHK
IVDIISLIDSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAAAAKEIKEL
IDASVEKVDIGNRQVEQATSTMRDIVASVQRVSGIMGEIKEATQQQSAGINQVHEAITQM
DASTQQNASLVEEAAAAAGSLQEQTVRLLQAISVFKFNRR