Protein Info for HSERO_RS02020 in Herbaspirillum seropedicae SmR1

Annotation: tyrosyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR00234: tyrosine--tRNA ligase" amino acids 24 to 414 (391 residues), 383.4 bits, see alignment E=7.4e-119 PF00579: tRNA-synt_1b" amino acids 52 to 331 (280 residues), 275.7 bits, see alignment E=7.1e-86 PF13275: S4_2" amino acids 350 to 403 (54 residues), 29.3 bits, see alignment 1e-10 PF01479: S4" amino acids 360 to 399 (40 residues), 30.6 bits, see alignment 3.3e-11

Best Hits

Swiss-Prot: 78% identical to SYY_CUPNJ: Tyrosine--tRNA ligase (tyrS) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to hse:Hsero_0407)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX57 at UniProt or InterPro

Protein Sequence (416 amino acids)

>HSERO_RS02020 tyrosyl-tRNA synthetase (Herbaspirillum seropedicae SmR1)
MNADQSTPTAAPSKMPLSDKVLEALAITKRGIDELLIESEFAQKLARAEQSGQPLRIKLG
LDPTAPDLHLGHTVVLNKMRQLQNLGHQVIFLIGDFTSMIGDPSGRNATRPPLSREQIEI
NAKTYFAQASLVLDPSKTEIRYNSEWCDALGSRGMIQLASRYTVARMMERDDFTKRFKEG
TPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLVGRELQKDFGQEPQCILTMPLLE
GLDGVEKMSKSKGNYIGITEPANTMFAKVMSISDVMMWRYYDLLSFRSMAEIAGYKAEVD
AGKNPRDIKVALAQEIVARFHSQQAAEDALADFVNRSKGGIPDDIPEVSLTGAPLGIGQL
LKQANLCASTSEALRMVEQGGVRIDGTVISDKGLKVEAGQCVVQVGKRKFARVTLA